Generated on December 21 2025 11:41 AM
Old data? UPDATE !
The score is 50/100
Title
Сергей Коноваленко — Разработка продающих сайтов "под ключ"
Length : 59
Perfect, your title contains between 10 and 70 characters.
Description
Length : 0
Very bad. We haven't found meta description on your page. Use this free online meta tags generator to create description.
Keywords
Very bad. We haven't found meta keywords on your page. Use this free online meta tags generator to create keywords.
Og Meta Properties
This page does not take advantage of Og Properties. This tags allows social crawler's better structurize your page. Use this free og properties generator to create them.
Headings
| H1 | H2 | H3 | H4 | H5 | H6 |
| 1 | 1 | 0 | 0 | 0 | 0 |
Images
We found 2 images on this web page.
1 alt attributes are empty or missing. Add alternative text so that search engines can better understand the content of your images.
Text/HTML Ratio
Ratio : 32%
Ideal! This page's ratio of text to HTML code is between 25 and 70 percent.
Flash
Perfect, no Flash content has been detected on this page.
Iframe
Great, there are no Iframes detected on this page.
URL Rewrite
Good. Your links looks friendly!
Underscores in the URLs
Perfect! No underscores detected in your URLs.
In-page links
We found a total of 9 links including 0 link(s) to files
| Anchor | Type | Juice |
|---|---|---|
| https://freelance.ru/sergeykonovalenko | External | Passing Juice |
| https://freelance.ru/reviews/sergeykonovalenko | External | Passing Juice |
| https://t.me/sergeykonovalenko | External | Passing Juice |
| Viber, | External | Passing Juice |
| WhatsApp: | External | Passing Juice |
| https://www.facebook.com/sergeyfreelance | External | Passing Juice |
| https://vk.com/sergey_konovalenko | External | Passing Juice |
| https://www.instagram.com/sergeyfreelance | External | Passing Juice |
| https://github.com/sergeykonovalenko | External | Passing Juice |
Keywords Cloud
sergeykonovalenko5550199 skype httpsvksergeykonovalenko viber sergeykonovalenko5550199gmail github instagram httpswwwinstagramsergeyfreelance почта сергей
Keywords Consistency
| Keyword | Content | Title | Keywords | Description | Headings |
|---|---|---|---|---|---|
| сергей | 1 | ![]() |
![]() |
![]() |
![]() |
| viber | 1 | ![]() |
![]() |
![]() |
![]() |
| github | 1 | ![]() |
![]() |
![]() |
![]() |
| sergeykonovalenko5550199gmail | 1 | ![]() |
![]() |
![]() |
![]() |
| почта | 1 | ![]() |
![]() |
![]() |
![]() |
Url
Domain : sergeykonovalenko.com.ua
Length : 24
Favicon
Very bad. We have not found shortcut icon. Icons are one of easy ways to attract regular visitors to your website more often.
Printability
We could not find a Print-Friendly CSS.
Language
Good. Your declared language is en.
Dublin Core
This page does not take advantage of Dublin Core.
Doctype
HTML 5
Encoding
Perfect. Your declared charset is UTF-8.
W3C Validity
Errors : 0
Warnings : 0
Email Privacy
Warning! At least one email address has been found in the plain text. Use free antispam protector to hide email from spammers.
Deprecated HTML
Great! We haven't found deprecated HTML tags in your HTML.
Speed Tips
![]() |
Excellent, your website doesn't use nested tables. |
![]() |
Too bad, your website is using inline styles. |
![]() |
Great, your website has few CSS files. |
![]() |
Perfect, your website has few JavaScript files. |
![]() |
Perfect, your website takes advantage of gzip. |
Mobile Optimization
![]() |
Apple Icon |
![]() |
Meta Viewport Tag |
![]() |
Flash content |
XML Sitemap
Missing
Your website does not have an XML sitemap - this can be problematic.
A sitemap lists URLs that are available for crawling and can include additional information like your site's latest updates, frequency of changes and importance of the URLs. This allows search engines to crawl the site more intelligently.
Robots.txt
http://sergeykonovalenko.com.ua/robots.txt
Great, your website has a robots.txt file.
Analytics
Great, your website has an analytics tool.
Google Analytics |
This free SEO tool will help you analyze any website for technical errors and identify parameters that can be improved for more successful search engine rankings. To get started, enter the URL or domain name of the website you want to audit and click the Analyze button. The analysis result with recommendations will be available in 5-10 seconds